rabbit IGF-1 protein Rabbit 50 µg

In stock

Cat-Nr.
500-024
Size
50 µg
€255.00

Description / rabbit IGF-1 protein

IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rabbit IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7639 Dalton.

More Information

Size 50 µg
Source E. coli
Biological Activity rbIGF-I is biologically active when compared to human IGF-1. The ED50, calculated by the dose -dependent proliferation of human MCF/7 cells is 5 to 25 ng/ml in the cell culture mixture dependent on culture conditions. Its activity consisits of 30-40 % com
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 72
Molecular Weight 7.6 kDa
Species Reactivity Rabbit
Formulation lyophilized
Protein Sequence MTGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA
Reconstitution It is recommended to reconstitute the lyophilized rbIGF-I in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Igf1; Igf-1; Igf-I; C730016P09Rik
Uniprot ID Q95222
Protein RefSeq NP_001075495.1
mRNA RefSeq NM_001082026.1

All prices plus VAT + possible delivery charges