mouse I-TAC (CXCL11) protein Mouse 250 µg

In stock

Cat-Nr.
M10-086-L250
Size
250 µg
€1,160.00

Description / mouse I-TAC (CXCL11) protein

I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.

More Information

Size 250 µg
Source E. coli
Biological Activity Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 79
Molecular Weight 9.0 kDa
Species Reactivity Human, Mouse, Monkey, Bacteria
Formulation lyophilized
Protein Sequence FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Synonyms CXCL11
Uniprot ID Q9JHH5
Protein RefSeq NP_062367.1
mRNA RefSeq NM_019494.1

All prices plus VAT + possible delivery charges