mouse I-TAC (CXCL11) protein Mouse 5 µg

In stock

Cat-Nr.
M10-086S
Size
5 µg
€90.00

Description / mouse I-TAC (CXCL11) protein

I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.

More Information

Size 5 µg
Source E. coli
Biological Activity Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 79
Molecular Weight 9.0 kDa
Species Reactivity Human, Mouse, Monkey, Bacteria
Formulation lyophilized
Protein Sequence FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Synonyms CXCL11
Uniprot ID Q9JHH5
Protein RefSeq NP_062367.1
mRNA RefSeq NM_019494.1

All prices plus VAT + possible delivery charges