mouse I-TAC (CXCL11) protein Mouse 20 µg
Description / mouse I-TAC (CXCL11) protein
I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml. |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 79 |
| Molecular Weight | 9.0 kDa |
| Species Reactivity | Human, Mouse, Monkey, Bacteria |
| Formulation | lyophilized |
| Protein Sequence | FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM |
| Synonyms | CXCL11 |
| Uniprot ID | Q9JHH5 |
| Protein RefSeq | NP_062367.1 |
| mRNA RefSeq | NM_019494.1 |

