human I-TAC (CXCL11) (Animal Free) protein Human 5 µg

In stock

Cat-Nr.
100-058S-AF
Size
5 µg
  €113.00

Description / human I-TAC (CXCL11) (Animal Free) protein

I-TAC is a 'non-ELR' CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, ormonocytes. Recombinant Human I-TAC (CXCL11) is an 8.3 kDa protein containing 73 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines. 

More Information

Size 5 µg
Source E. coli
Biological Activity Determined by its ability to chemoattract human T-cells activated with IL-2.
Purity Confirmation ≥ 98% by SDS-PAGE gel and HPLC analyses.
Length [aa] 73
Molecular Weight 8.3 kDa
Species Reactivity Hamster, Mouse, Rabbit, Human, Monkey
Formulation lyophilized
Protein Sequence FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Synonyms CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Uniprot ID O14625
Protein RefSeq NP_005400.1
mRNA RefSeq NM_005409.4

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P49
€283.00

In stock

All prices plus VAT + possible delivery charges