Description / human I-TAC (CXCL11) (Animal Free) protein
I-TAC is a 'non-ELR' CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, ormonocytes. Recombinant Human I-TAC (CXCL11) is an 8.3 kDa protein containing 73 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines.
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to chemoattract human T-cells activated with IL-2. |
| Purity Confirmation | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Length [aa] | 73 |
| Molecular Weight | 8.3 kDa |
| Species Reactivity | Hamster, Mouse, Rabbit, Human, Monkey |
| Formulation | lyophilized |
| Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Synonyms | CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B |
| Uniprot ID | O14625 |
| Protein RefSeq | NP_005400.1 |
| mRNA RefSeq | NM_005409.4 |

