human I-TAC (CXCL11) protein Human 100 µg

In stock

Cat-Nr.
100-058-L100
Size
100 µg
€661.00

Description / human I-TAC (CXCL11) protein

Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.

More Information

Size 100 µg
Source E. coli
Biological Activity Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 73
Molecular Weight 8.3 kDa
Species Reactivity Hamster, Mouse, Rabbit, Human, Monkey
Formulation lyophilized
Protein Sequence FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Synonyms CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Uniprot ID O14625
Protein RefSeq NP_005400.1
mRNA RefSeq NM_005409.4

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P49
€283.00

In stock

All prices plus VAT + possible delivery charges