human I-TAC (CXCL11) protein Human 50 µg
Description / human I-TAC (CXCL11) protein
Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml. |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 73 |
| Molecular Weight | 8.3 kDa |
| Species Reactivity | Hamster, Mouse, Rabbit, Human, Monkey |
| Formulation | lyophilized |
| Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Synonyms | CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B |
| Uniprot ID | O14625 |
| Protein RefSeq | NP_005400.1 |
| mRNA RefSeq | NM_005409.4 |

