human CD34, soluble protein Human 20 µg
Description / human CD34, soluble protein
CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein.
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Data not available. |
| Purity Confirmation | ≥ 95 % by SDS-PAGE gel |
| Length [aa] | 241 |
| Molecular Weight | 28.3 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | MTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNFCSAVQYGNAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTMLQCLKQNKNSELMDPKCKQMITKRQITQNTDYRLNPMLRKACKADIPKFCHGILTKAKDDSELEGQVISCLKLRYADQRLSSDCEDQIRIIIQESALDYRLDPQLQLHCSDEISSLCAELEHHHHHH |
| Reconstitution | Centrifuge the vial prior to opening. Do not vortex. The lyophilized ESL-1 should be reconstituted in sterile water to a concentration of 0.1 mg/mL. |
| Stability and Storage | Lyophilized product is stable for greater than 1 year at -20 °C to -80 °C. Reconstituted samples can be kept at 2 °C to 8 °C for up to 1 week and should be stored in working aliquots at -20 °C. Avoid freeze-thaw cycles! |
| Synonyms | CD34 |
| Uniprot ID | P28906 |
| Protein RefSeq | NP_001764.1 |
| mRNA RefSeq | NM_001773.2 |