human HGF protein Human 25 µg

In stock

Cat-Nr.
300-011
Size
25 µg
  €214.00

Description / human HGF protein

Human Hepatocyte Growth Factor (HGF), also known as scatter factor, is a pleiotropic cytokine that shows homology to the enzymes of the blood coagulation cascade. It stimulates the motility and invasion of several cancer cell types and can induce angiogenesis. Recently HGF was found to be identical to scatter factor, a fibroblast-derived factor promoting the dissociation of epithelial and vascular endothelial cell colonies in monolayer cell cultures by stimulating cell migration. HGF is synthesized as a biologically inactive single chain precursor, which is cleaved by a specific, extracellular serum serine protease to a fully active heterodimer. This mature, biologically active HGF consists of a disulfide-linked alpha-beta heterodimer of the two cleavage products. Previous studies have shown that single chain and heterodimeric HGF are equally active in vitro assay systems due to either production of the serine protease in cell culture or the presence of the ubiquitous protease in serum. All biological responses induced by HGF are elicited by binding to its transmembrane tyrosine kinase receptor, which is encoded by the MET proto-oncogene. After autophosphorylation of the receptor different cytoplasmic effectors are activated that bind to the same multifunctional docking site of the receptor. HGF function is essential for normal development. Knockout studies have demonstrated that both ligand and receptor deficient mice display an embryonic lethal phenotype. Hepatocytes have to be primed before they can fully respond to HGF. This priming requires cytokines as TNF and IL-6. Recent studies have suggested that HGF synergizes with basic FGF in the induction of angiogenesis.

More Information

Size 25 µg
Source Insect cells
Biological Activity The activity was determined by a proliferation assay with MDCK cells using the WHO standard 96/564 as control. The ED50 for this effect is typically at 2.0 – 5.0 ng/ml.
N Terminal Sequence MAPARSPST
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 697
Molecular Weight 78.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50 mM acetic acid
Protein Sequence QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN
Reconstitution The lyophilized human HGF is soluble in acetic acid (50 mM) and can be reconstituted to a concentration of 100 µg/ml. Further dilutions should be made into buffer containing protein or medium containing serum.
Stability and Storage The lyophilized HGF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted it should be stored in working aliquots at -20°C to -70°C. Avoid repeated freeze-thaw cycles.
Synonyms HGF; SF; HGFB; HPTA; F-TCF; DFNB39; Hepatocyte growth factor; Scatter factor; rh HGF
Uniprot ID P14210
Protein RefSeq NP_000592
mRNA RefSeq NM_000601
Adult stem cells-derived organoids Endometrium, Gallbladder, Liver
Pluripotent stem cells-derived organoids Liver, Mammary

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M449
€453.00

In stock

SKU: 101-M769
€453.00

In stock

SKU: 102-PA62
€316.00

In stock

SKU: 102-PA62AG
€193.00

In stock

All prices plus VAT + possible delivery charges