ovine Growth Hormone Receptor (hGH binding protein), soluble protein Ovine 5 µg

In stock

Cat-Nr.
500-014S
Size
5 µg
  €181.00

Description / ovine Growth Hormone Receptor (hGH binding protein), soluble protein

Recombinant oGHBP, one polypeptide chain containing 244 amino acids and having a molecular mass of ~ 28 kDa, hGHBP was purified by proprietary chromatographic techniques, (see Herman et al. J Biol Chem. (1999) 274, 7631-9.

More Information

Size 5 µg
Source E. coli
Biological Activity oGHBP is fully biologically active as evidenced by its ability of forming 2:1 complex with hGH.
N Terminal Sequence AFSGS
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 244
Molecular Weight 28.0 kDa
Formulation lyophilized
Protein Sequence AFSGSEATPAFFVRASQSLQILYPGLETNSSGNLKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLLVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQF
Reconstitution It is recommended to reconstitute the lyophilized oGHBP in DDW or sterile 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions preferably in presence of carrier proteins such as BSA or HSA.
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID Q28575
Protein RefSeq NP_001009323.1
mRNA RefSeq NM_001009323.2

All prices plus VAT + possible delivery charges