Description / ovine Growth Hormone Receptor (hGH binding protein), soluble protein
Recombinant oGHBP, one polypeptide chain containing 244 amino acids and having a molecular mass of ~ 28 kDa, hGHBP was purified by proprietary chromatographic techniques, (see Herman et al. J Biol Chem. (1999) 274, 7631-9.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | oGHBP is fully biologically active as evidenced by its ability of forming 2:1 complex with hGH. |
| N Terminal Sequence | AFSGS |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 244 |
| Molecular Weight | 28.0 kDa |
| Formulation | lyophilized |
| Protein Sequence | AFSGSEATPAFFVRASQSLQILYPGLETNSSGNLKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLLVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQF |
| Reconstitution | It is recommended to reconstitute the lyophilized oGHBP in DDW or sterile 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions preferably in presence of carrier proteins such as BSA or HSA. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | Q28575 |
| Protein RefSeq | NP_001009323.1 |
| mRNA RefSeq | NM_001009323.2 |

