human Growth Hormone, pituitary 22K protein Human 100 µg

In stock

Cat-Nr.
500-005S
Size
100 µg
  €216.00

Description / human Growth Hormone, pituitary 22K protein

Growth Hormone (GH), also known as somatotropin, is a pleiotropic cytokine of the hematopoietic growth factor superfamily, which encompasses most cytokines, hematopoietic growth factors, and related receptors, and includes the related growth hormone receptor, prolactin, placental lactogens, proliferins, and somatolactin (SST). GH is primarily recognized for its anabolic role in stimulating the growth and differentiation of muscle, bone, and cartilage. A number of other functions, including immunomodulatory actions, are also attributed to GH, due in part to the pervasive distribution of its receptors, and the indirect effects associated with GH-stimulated production of insulin-like growth factors (IGFs). Occurring predominantly in the somatotropes of the anterior pituitary, whereupon it is stored in secretory granules, production of GH has also been noted in many other tissues, including those of the hematopoietic system. The production and pulsatile release of circulating GH is very tightly regulated by both negative and positive feedback regulations of pituitary and hypothalamic hormones, such as Pituitary-specific Positive Transcription Factor 1 (POU1F1), Growth Hormone Releasing Hormone (GHRH), and somatostatin (SRIF). Deficient production of GH is associated with dwarfism and reduction of lean body mass, while overproduction is associated with acromegaly and gigantism, as well as breast tumor growth. Recombinant Human Growth Hormone is a 22.3 kDa, single, non-glycosylated polypeptide chain containing 192 amino acid residues.

More Information

Size 100 µg
Source E. coli
Biological Activity Recombinant pituitary human growth hormone 22K is fully biologically active when compared to WHO reference standard as evidenced by several in vitro bioassays. Recombinant pituitary human growth hormone 20K is also capable of forming a 1:2 complex with th
N Terminal Sequence AFPTI
Purity Confirmation > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
Length [aa] 192
Molecular Weight 22.3 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Reconstitution It is recommended to reconstitute the lyophilized recombinant pituitary human growth hormone 22K in 0.4% NaHCO3 adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P01241-1
Protein RefSeq NP_000506.2
mRNA RefSeq NM_000515.4

All prices plus VAT + possible delivery charges