zebrafish Growth Hormone mutant (G119R) protein Zebrafish 2 µg

In stock

Cat-Nr.
500-023S
Size
2 µg
€181.00

Description / zebrafish Growth Hormone mutant (G119R) protein

Recombinant zebrafish growth hormone mutant G119R (zbGH mutant) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 185 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21187 Dalton.

More Information

Size 2 µg
Source E. coli
Biological Activity The biologically activity of zfGH mutant in PDF-P1 3B9 cells stably transfected with rabbit GH receptors has not yet been tested.
N Terminal Sequence AQRLFN
Purity Confirmation > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
Length [aa] 186
Molecular Weight 21.1 kDa
Formulation lyophilized
Protein Sequence AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNQITEKLADLKMGISVLIKRCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Reconstitution It is recommended to reconstitute the lyophilized zfGH mutant in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of car
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID Q1JQ34
Protein RefSeq NP_001018328.2
mRNA RefSeq NM_001020492.2

All prices plus VAT + possible delivery charges