zebrafish Growth Hormone mutant (G119R) protein Zebrafish 10 µg
Description / zebrafish Growth Hormone mutant (G119R) protein
Recombinant zebrafish growth hormone mutant G119R (zbGH mutant) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 185 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21187 Dalton.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The biologically activity of zfGH mutant in PDF-P1 3B9 cells stably transfected with rabbit GH receptors has not yet been tested. |
| N Terminal Sequence | AQRLFN |
| Purity Confirmation | > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
| Length [aa] | 186 |
| Molecular Weight | 21.1 kDa |
| Formulation | lyophilized |
| Protein Sequence | AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNQITEKLADLKMGISVLIKRCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Reconstitution | It is recommended to reconstitute the lyophilized zfGH mutant in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of car |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | Q1JQ34 |
| Protein RefSeq | NP_001018328.2 |
| mRNA RefSeq | NM_001020492.2 |

