rat Growth Hormone antagonist (G119R) protein Rat 1000 µg

In stock

Cat-Nr.
500-018-L1000
Size
1000 µg
  €3,116.00

Description / rat Growth Hormone antagonist (G119R) protein

Recombinant rat GH-22K G119R produced in E. coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids and having a molecular mass of 22 kDa. It is mutated in single amino acid (G119R) according to similar bovine GH mutein described by Chen et al. (1991), Molecular Endocrinology 5:1845–1852.

More Information

Size 1000 µg
Source E. coli
Biological Activity rGH G119R acts as antagonist using an in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. It is capable of forming a 1:1 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD)and binds to this
N Terminal Sequence AFPAM
Purity Confirmation > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
Length [aa] 191
Molecular Weight 22.0 kDa
Formulation lyophilized
Protein Sequence AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEERIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
Reconstitution It is recommended to reconstitute the lyophilized rGH G119R in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or simila
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P01244
Protein RefSeq NP_001030020.2
mRNA RefSeq NM_001034848.2

All prices plus VAT + possible delivery charges