Description / rat Growth Hormone antagonist (G119R) protein
Recombinant rat GH-22K G119R produced in E. coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids and having a molecular mass of 22 kDa. It is mutated in single amino acid (G119R) according to similar bovine GH mutein described by Chen et al. (1991), Molecular Endocrinology 5:1845–1852.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | rGH G119R acts as antagonist using an in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. It is capable of forming a 1:1 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD)and binds to this |
| N Terminal Sequence | AFPAM |
| Purity Confirmation | > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
| Length [aa] | 191 |
| Molecular Weight | 22.0 kDa |
| Formulation | lyophilized |
| Protein Sequence | AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEERIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF |
| Reconstitution | It is recommended to reconstitute the lyophilized rGH G119R in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or simila |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | P01244 |
| Protein RefSeq | NP_001030020.2 |
| mRNA RefSeq | NM_001034848.2 |

