rat Growth Hormone protein Rat 1000 µg
Description / rat Growth Hormone protein
Recombinant rat GH-22K produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 22367 Dalton.
More Information
| Size | 1000 µg |
|---|---|
| Source | E. coli |
| Biological Activity | rGH is fully biologically active when compared to WHO reference standard using in vitro bioassay. It is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD). |
| N Terminal Sequence | AFPAM |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 192 |
| Molecular Weight | 22.3 kDa |
| Formulation | lyophilized |
| Protein Sequence | AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF |
| Reconstitution | It is recommended to reconstitute the lyophilized rGH in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | P01244 |
| Protein RefSeq | NP_001030020.2 |
| mRNA RefSeq | NM_001034848.2 |

