ovine Growth Hormone protein Ovine 1000 µg

In stock

Cat-Nr.
500-012-L1000
Size
1000 µg
€1,688.00

Description / ovine Growth Hormone protein

More Information

Size 1000 µg
Source E. coli
Biological Activity oGH is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. It is also capable of forming a 1:2 complex with the recombinant ovine growth hormone recepto
N Terminal Sequence ATFPA
Purity Confirmation > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
Length [aa] 191
Molecular Weight 21.8 kDA
Formulation lyophilized
Protein Sequence AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Reconstitution It is recommended to reconstitute the lyophilized oGH in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P67930
Protein RefSeq NP_001009315.2
mRNA RefSeq NM_001009315.3

All prices plus VAT + possible delivery charges