rat Growth Hormone protein Rat 100 µg

In stock

Cat-Nr.
500-017S
Size
100 µg
€384.00

Description / rat Growth Hormone protein

Recombinant rat GH-22K produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 22367 Dalton.

More Information

Size 100 µg
Source E. coli
Biological Activity rGH is fully biologically active when compared to WHO reference standard using in vitro bioassay. It is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD).
N Terminal Sequence AFPAM
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 192
Molecular Weight 22.3 kDa
Formulation lyophilized
Protein Sequence AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
Reconstitution It is recommended to reconstitute the lyophilized rGH in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P01244
Protein RefSeq NP_001030020.2
mRNA RefSeq NM_001034848.2

All prices plus VAT + possible delivery charges