Description / ovine Growth Hormone protein
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | oGH is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. It is also capable of forming a 1:2 complex with the recombinant ovine growth hormone recepto |
| N Terminal Sequence | ATFPA |
| Purity Confirmation | > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
| Length [aa] | 191 |
| Molecular Weight | 21.8 kDA |
| Formulation | lyophilized |
| Protein Sequence | AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
| Reconstitution | It is recommended to reconstitute the lyophilized oGH in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | P67930 |
| Protein RefSeq | NP_001009315.2 |
| mRNA RefSeq | NM_001009315.3 |

