bovine Growth Hormone protein Bovine 100 µg

In stock

Cat-Nr.
500-009
Size
100 µg
€255.00

Description / bovine Growth Hormone protein

Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

More Information

Size 100 µg
Source E. coli
Biological Activity Recombinant bovine growth hormone is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. Recombinant bovine growth hormone is also capable of forming a
N Terminal Sequence AFPAM
Purity Confirmation > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
Length [aa] 191
Molecular Weight 21.8 kDa
Species Reactivity Bovine
Formulation lyophilized
Protein Sequence AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Reconstitution It is recommended to reconstitute the lyophilized recombinant bovine growth hormone in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg recombinant bovine growth hormone per ml, which can then be further diluted to other aqueous solutions, prefe
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P01246
Protein RefSeq NP_851339.1
mRNA RefSeq NM_180996.1

All prices plus VAT + possible delivery charges