mouse GM-CSF protein Mouse 2 µg

In stock

Cat-Nr.
M30-012S
Size
2 µg
  €61.00

Description / mouse GM-CSF protein

GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 125 amino acids residues.

More Information

Size 2 µg
Source E. coli
Biological Activity Testing in Progress.
N Terminal Sequence MAPTRSPITV
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 125
Molecular Weight 14.2 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer 30 mM Tris pH8
Protein Sequence MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Reconstitution The lyophilized mouse GM-CSF is soluble in water and most aqueous buffers. It can be reconstituted in water to a concentration of 100 µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. For most in vitro ap
Stability and Storage The lyophilized mouse GM-CSF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted mouse GM-CSF should be stored in working aliquots at -20°C.
Synonyms Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM
Uniprot ID P01587
Protein RefSeq NP_034099.2
mRNA RefSeq NM_009969.4

All prices plus VAT + possible delivery charges