Description / mouse GM-CSF protein
GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 125 amino acids residues.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Testing in Progress. |
| N Terminal Sequence | MAPTRSPITV |
| Purity Confirmation | > 98% by SDS-PAGE |
| Length [aa] | 125 |
| Molecular Weight | 14.2 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | 30 mM Tris pH8 |
| Protein Sequence | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
| Reconstitution | The lyophilized mouse GM-CSF is soluble in water and most aqueous buffers. It can be reconstituted in water to a concentration of 100 µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. For most in vitro ap |
| Stability and Storage | The lyophilized mouse GM-CSF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted mouse GM-CSF should be stored in working aliquots at -20°C. |
| Synonyms | Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM |
| Uniprot ID | P01587 |
| Protein RefSeq | NP_034099.2 |
| mRNA RefSeq | NM_009969.4 |

