FGFR-3(IIIc)/Fc Chimera, soluble Human 50 µg

In stock

Cat-Nr.
SFC-020
Size
50 µg
  €310.00

Description / FGFR-3(IIIc)/Fc Chimera, soluble

Recombinant human soluble FGFR-3 alpha (IIIc) was fused via a Xa cleavage site with the Fc part of human IgG1. Human recombinant soluble FGFR-3 alpha (IIIc)/Fc is a disulfide-linked heterodimeric protein. In the reduced form the glycosylated subunits of sFGFR-3 alpha/human Fc chimera display a molecular mass of 80-85 kDa.Fibroblast Growth Factors (FGFs) comprise a family of at least eighteen structurally related proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentiation, angiogenesis, wound healing and tumorigenesis. The biological activities of the FGFs are mediated by a family of type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGFR-1 to -4 are known. Multiple forms of FGFR-1 to -3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGFR-1 and -2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the ß isoform. Only the alpha isoform has been identified for FGFR-3 and FGFR-4. Additional splicing events for FGFR-1 to -3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc). A IIIa isoform which is a secreted FGF binding protein containing only the N-terminal half of the IgIII domain plus some intron sequences has also been reported for FGFR-1. Mutations in FGFR-1 to -3 have been found in patients with birth defects involving craniosynostosis.

More Information

Size 50 µg
Source Insect cells
Biological Activity Measured by its binding ability to FGF-2 in a functional ELISA. Recombinant human soluble FGFR-3(IIIc)/Fc Chimera binds to immobilized recombinant human FGF-2 (Cat #300-001).
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 593
Molecular Weight 65.1kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKV
Reconstitution The lyophilized sFGFR-3/Fc is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sFGFR-3/Fc should be stored in working aliquots at -20°C.
Synonyms FGFR3; ACH; CEK2; JTK4; CD333; HSFGFR3EX
Uniprot ID P22607
Protein RefSeq NP_000133
mRNA RefSeq NM_000142

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M737
€533.00

In stock

All prices plus VAT + possible delivery charges