human FGFR-3(IIIb)/Fc Chimera, soluble protein Human 50 µg

In stock

Cat-Nr.
SFC-025
Size
50 µg
  €214.00

Description / human FGFR-3(IIIb)/Fc Chimera, soluble protein

Fibroblast growth factors (FGFs) comprise a family of at least 23 structurally related proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentiation, angiogenesis, wound healing and tumorgenesis. The biological activities of the FGFs are mediated by a family of type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGFR1-4, are known. All four genes for FGFRs encode proteins with an N-terminal signal peptide, three immunoglobulin (Ig)-like domains, an acid-box region containing a run of acidic residues between the IgI and IgII domains, a transmembrane domain and the split tyrosine-kinase domain. Multiple forms of FGFR1-3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGFR1 and 2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the beta isoform. Only the alpha isoform has been identified for FGFR3 and FGFR4. Additional splicing events for FGF R1-3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc). A IIIa isoform which is a secreted FGF binding protein containing only the N-terminal half of the IgIII domain plus some intron sequences has also been reported for FGFR1. Mutations in FGFR1-3 have been found in patients with birth defects involving craniosynostosis. The complex patterns of expression of these receptors as well as the specificity of their interactions with the various FGF ligand family members are under investigation.

More Information

Size 50 µg
Source Insect cells
Biological Activity Measured by its binding ability to aFGF and FGF2 in a functional ELISA. In addition recombinant human soluble FGFR-3(IIIb)/Fc Chimera also binds to immobilized recombinant human FGF9 and FGF18.
N Terminal Sequence ESLGT
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 585
Molecular Weight 65.0kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKV
Synonyms Fibroblast growth factor receptor 3, FGFR-3/ CD333
Uniprot ID P22607-2
Protein RefSeq NP_001156685.1
mRNA RefSeq NM_001163213.1

All prices plus VAT + possible delivery charges