human FGF-4 protein Human 5 µg

In stock

Cat-Nr.
300-130
Size
5 µg
  €85.00

Description / human FGF-4 protein

FGF-4 (fibroblast growth factor 4), also known as K-FGF (Kaposi’s sarcoma associated FGF), is a 25 kDa secreted, heparin binding member of the FGF family. The human FGF-4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C terminus. Mature human FGF-4 shares a high aa identity with mouse, rat, canine and bovine FGF-4, respectively. The expression of FGF-4 and its receptors, FGF-R1c, -R2c, -R3c and R4, is spatially and temporally regulated during embryonic development. Its expression in the mouse trophoblast inner cell mass promotes expression of FGF-R2, and is required for maintenance of the trophectoderm and primitive endoderm. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in-vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in-vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in-vivo and has been investigated as therapy for coronary artery disease.

More Information

Size 5 µg
Source E. coli
Biological Activity The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
N Terminal Sequence MAPTAPNGTL
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 177
Molecular Weight 19.7 kDa
Species Reactivity Mouse, Rat, Human, Pig
Formulation lyophilized
Buffer PBS
Protein Sequence APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLP RL
Reconstitution We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
Stability and Storage The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted FGF-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.
Synonyms FGF4; HST; KFGF; HST-1; HSTF1; K-FGF; HBGF-4
Uniprot ID P08620
Protein RefSeq NP_001998.1
mRNA RefSeq NM_002007
Adult stem cells-derived organoids Intestine, Lung
Pluripotent stem cells-derived organoids Lung, Pancreas, Stomach

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P258
€271.00

In stock

All prices plus VAT + possible delivery charges