bovine FGF-21 protein Bovine 50 µg

In stock

Cat-Nr.
500-003
Size
50 µg
€255.00

Description / bovine FGF-21 protein

Bovine FGF-21 is a secreted growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. Recombinant bovine FGF-21 is a 19.5 kDa protein containing 182 amino acid residues.

More Information

Size 50 µg
Source E. coli
Biological Activity Not tested!
N Terminal Sequence AHPIP
Purity Confirmation > 98% by SDS-PAGE & gel filtration
Length [aa] 182
Molecular Weight 19.5 kDa
Species Reactivity Bovine
Formulation lyophilized
Protein Sequence AHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHLEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKACSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAAPPDPPGILAPEPPDVGSSDPLSMVGPSYGRSPSYTS
Reconstitution It is recommended to reconstitute the lyophilized bFGF-21 in 0.4% NaHCO3 or water, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar
Synonyms Fibroblast Growth Factor-21, FGFL
Uniprot ID E1BDA6
Protein RefSeq XP_005219543.1
mRNA RefSeq XM_005219486.4

All prices plus VAT + possible delivery charges