Description / human FABP5 protein
Human FABP5, also known as epidermal fatty acid binding protein (E-FABP), is a 15 kDa member of a cytosolic fatty acid binding protein superfamily. It is associated with keratinocytes and adipocytes and is suggested to promote fatty acid availability to enzymes, protect cell structures from fatty acid attack, and target fatty acids to nuclear transcription factors. The amino acid sequence of human FABP5 is 80%, 81% and 92% identical to that of mouse, rat and bovine FABP5, respectively.
More Information
| Size | 25 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Data not available. |
| N Terminal Sequence | ATVQQ |
| Purity Confirmation | > 98% by SDS-PAGE & visualized by Coomassie stain |
| Length [aa] | 143 |
| Molecular Weight | 16.1 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHHHH |
| Reconstitution | Centrifuge vial prior to opening. Human FABP5 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C. |
| Stability and Storage | The lyophilized human FABP5, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human FABP5 should be stored in working aliquots at -20°C. |
| Synonyms | Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP |
| Uniprot ID | Q01469 |
| Protein RefSeq | NP_001435 |
| mRNA RefSeq | NM_001444 |

