human FABP5 protein Human 25 µg

In stock

Cat-Nr.
400-024
Size
25 µg
€214.00

Description / human FABP5 protein

Human FABP5, also known as epidermal fatty acid binding protein (E-FABP), is a 15 kDa member of a cytosolic fatty acid binding protein superfamily. It is associated with keratinocytes and adipocytes and is suggested to promote fatty acid availability to enzymes, protect cell structures from fatty acid attack, and target fatty acids to nuclear transcription factors. The amino acid sequence of human FABP5 is 80%, 81% and 92% identical to that of mouse, rat and bovine FABP5, respectively.

More Information

Size 25 µg
Source E. coli
Biological Activity Data not available.
N Terminal Sequence ATVQQ
Purity Confirmation > 98% by SDS-PAGE & visualized by Coomassie stain
Length [aa] 143
Molecular Weight 16.1 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHHHH
Reconstitution Centrifuge vial prior to opening. Human FABP5 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage The lyophilized human FABP5, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human FABP5 should be stored in working aliquots at -20°C.
Synonyms Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP
Uniprot ID Q01469
Protein RefSeq NP_001435
mRNA RefSeq NM_001444

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA142
€316.00

In stock

SKU: 102-PA142S
€193.00

In stock

SKU: 102-PA142AG
€193.00

In stock

All prices plus VAT + possible delivery charges