human ESAM protein Human 100 µg

In stock

Cat-Nr.
300-057-L100
Size
100 µg
€293.00

Description / human ESAM protein

Endothelial cell selective adhesion molecule (ESAM) is a 55 kDa type I transmembrane glycoprotein that belongs to the JAM family of immunoglobulin superfamily molecules. Human ESAM is synthesized as a 390 amino acid (aa) protein composed of a 29 aa signal peptide, a 216 aa extracellular region, a putative 26 aa transmembrane segment, and a 119 aa cytoplasmic domain. The extracellular region contains one V-type and one C2-type Ig domain and is involved in hemophilic adhesion. In the cytoplasmic domain, there is a docking site for the multifunctional adaptor protein MAGI1. The extracellular region of human ESAM shows 90%, 74%, 69% and 67% aa identity with monkey, canine, mouse and rat extracellular ESAM, respectively. ESAM is expressed on endothelial cells, activated platelets and megakaryocytes, and can be found associated with cell to cell junctions. Whether ESAM is restricted to a particular junctional type is not clear. ESAM deficient mice have no defect in vascularization but do have reduced angiogenic potential. This may be due to a decreased migratory response to FGF2. Soluble ESAM is fused to a C-terminal His-tag (6x His).

More Information

Size 100 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 95% by SDS-PAGE
Molecular Weight 27.8 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence ISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGARSHHHHHH
Reconstitution Human ESAM should be reconstituted in sterile water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage The lyophilized human ESAM, though stable at room temperature, is best stored desiccated below 0°C.
Synonyms ESAM; W117m
Uniprot ID Q96AP7
Protein RefSeq NP_620411.2
mRNA RefSeq NM_138961.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA42
€316.00

In stock

All prices plus VAT + possible delivery charges