Description / human Endomucin protein
Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Data not available. |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 197 |
| Molecular Weight | 20.4 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | 10mM NaP, pH 7.0 |
| Protein Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS |
| Reconstitution | The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100 µg/ml. |
| Stability and Storage | The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity. |
| Synonyms | Endomucin-2, Gastric cancer antigen Ga34, Mucin-14 |
| Uniprot ID | Q9ULC0 |
| Protein RefSeq | NP_001153166.1 |
| mRNA RefSeq | NM_001159694.1 |

