human Endomucin protein Human 20 µg

In stock

Cat-Nr.
S01-064
Size
20 µg
€316.00

Description / human Endomucin protein

Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.

More Information

Size 20 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 197
Molecular Weight 20.4 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 10mM NaP, pH 7.0
Protein Sequence MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
Reconstitution The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100 µg/ml.
Stability and Storage The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.
Synonyms Endomucin-2, Gastric cancer antigen Ga34, Mucin-14
Uniprot ID Q9ULC0
Protein RefSeq NP_001153166.1
mRNA RefSeq NM_001159694.1

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA49
€316.00

In stock

All prices plus VAT + possible delivery charges