mouse Endocan/ESM-1 protein Mouse 50 µg

In stock

Cat-Nr.
M30-062
Size
50 µg
€193.00

Description / mouse Endocan/ESM-1 protein

Endocan, also known as endothelial cell-specific molecule1 (ESM1), is a secreted cysteine-rich dermatan sulfate (DS) proteoglycan primarily expressed by endothelial cells within the vascular capillary network in kidney and in the alveolar walls of the lung. Endocan expression has also been detected in different epithelia and in adipocytes. The expression of endocan is up-regulated by TNFα, IL1β or lipopolysaccharide and down-regulated by IFNγ. The human Endocan gene encodes a 184 amino acid (aa) residues precursor protein with a 19 aa hydrophobic signal peptide and a 165 aa mature region with 18 Cysteine residues. The DS chain is covalently attached to serine 137. Endocan has been shown to bind CD11a/CD18 integrin (also known as lymphocyte function-associated antigen1, LFA1) on human lymphocytes, monocytes and Jurkat cells, inhibiting its binding to ICAM1 and reducing LFA1mediated leukocyte activation. Endocan binds via its DS chain to hepatocyte growth factor (HGF) to enhance HGF mitogenic activity. Genetically engineered cells overexpressing Endocan has been shown to induce tumor formation, suggesting that Endocan may be involved in the pathophysiology of tumor growth in vivo. Circulating Endocan can be detected in the serum from healthy subjects. In patients with lung cancer or acute and severe sepsis, elevated Endocan concentrations have been reported.

More Information

Size 50 µg
Source Insect cells
Biological Activity Testing in Progress.
N Terminal Sequence WSAKYAVD
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 173
Molecular Weight 19.07 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer water
Protein Sequence WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH
Reconstitution Mouse Endocan/ESM-1 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage The lyophilized mouse Endocan/ESM-1, though stable at room temperature, is best stored desiccated below 0°C.
Synonyms Esm1; ESM-1; AV004503; 0610042H23Rik; endothelial cell-specific molecule 1
Uniprot ID Q9QYY7
Protein RefSeq NP_076101.1
mRNA RefSeq NM_023612.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA44
€316.00

In stock

All prices plus VAT + possible delivery charges