rat CNTF protein Rat 25 µg

In stock

Cat-Nr.
R20-001
Size
25 µg
  €214.00

Description / rat CNTF protein

Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The cDNA for CNTF encodes a 200 amino acid residue polypeptide that lacks a signal sequence. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF, and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. The cDNA for recombinant rat CNTF (Ala2–Met200) was cloned from total RNA of a rat embryo using standard protocols. Ciliary Neurotrophic Factor (CNTF) is a potent neural factor that was originally characterized as a survivability factor for chick ciliary neurons in vitro. More recently, CNTF has been shown to promote survivability and differentiation of other neuronal cell types. Rat CNTF is a 22.7 kDa protein containing 199 amino acid residues.

More Information

Size 25 µg
Source E. coli
Biological Activity Measured in a cell proliferation assay using TF1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol 140, 1989). The ED50 for this effect is typically 3 - 15 ng/mL.
N Terminal Sequence AFAEQTPLTHR
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 199
Molecular Weight 22.7 kDa
Species Reactivity Rat
Formulation lyophilized
Buffer 5 mM sodium acetate, pH 6.5
Protein Sequence AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Reconstitution Rat CNTF should be reconstituted in PBS to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffered solutions.
Stability and Storage The lyophilized powder although stable at room temperature for 3 weeks, is best stored desiccated at -20°C. Reconstituted rat CNTF should be stored in working aliquots at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or
Synonyms Cntf
Uniprot ID P20294
Protein RefSeq NP_037298.1
mRNA RefSeq NM_013166.1

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 104-P01
€283.00

In stock

All prices plus VAT + possible delivery charges