rat CNTF (Animal Free) protein Rat 500 µg
Description / rat CNTF (Animal Free) protein
CNTF is a potent neural factor that was originally characterized as a vital factor for the survival of chick ciliary neurons in vitro. CNTF is also important for the survival of other neural cell types, including primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF is highly conserved across species and exhibits cross-species bioactivity. Recombinant Rat CNTF is synthesized as a 199 amino acid polypeptide (22.7 kDa) lacking a hydrophobic N-terminal signal for secretion.
More Information
| Size | 500 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to stimulate proliferation of human TF-1 cells using a concentration range of 25.0-35.0 ng/ml. |
| Purity Confirmation | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Length [aa] | 199 |
| Molecular Weight | 22.7 kDa |
| Species Reactivity | Frog, Human, Mouse, Rat |
| Formulation | lyophilized |
| Protein Sequence | AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Synonyms | Cntf |
| Uniprot ID | P20294 |
| Protein RefSeq | NP_037298.1 |
| mRNA RefSeq | NM_013166.1 |

