rat CNTF (Animal Free) protein Rat 250 µg

In stock

Cat-Nr.
R20-001-L250-AF
Size
250 µg
€1,275.00

Description / rat CNTF (Animal Free) protein

CNTF is a potent neural factor that was originally characterized as a vital factor for the survival of chick ciliary neurons in vitro. CNTF is also important for the survival of other neural cell types, including primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF is highly conserved across species and exhibits cross-species bioactivity. Recombinant Rat CNTF is synthesized as a 199 amino acid polypeptide (22.7 kDa) lacking a hydrophobic N-terminal signal for secretion.

More Information

Size 250 µg
Source E. coli
Biological Activity Determined by its ability to stimulate proliferation of human TF-1 cells using a concentration range of 25.0-35.0 ng/ml.
Purity Confirmation ≥ 98% by SDS-PAGE gel and HPLC analyses.
Length [aa] 199
Molecular Weight 22.7 kDa
Species Reactivity Frog, Human, Mouse, Rat
Formulation lyophilized
Protein Sequence AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Synonyms Cntf
Uniprot ID P20294
Protein RefSeq NP_037298.1
mRNA RefSeq NM_013166.1

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 104-P01
€283.00

In stock

All prices plus VAT + possible delivery charges