human CD27 ligand, soluble protein (His-Tag) Human 500 µg
Description / human CD27 ligand, soluble protein (His-Tag)
CD27 Ligand, a type II transmembrane protein, is a member of the TNF superfamily. It is expressed on activated T and B lymphocytes as well as NK cells. CD27 Ligand and its receptor (CD27) regulate the immune response by promoting T-cell expansion and differentiation, as well as NK enhancement. CD27 signalling can act as a costimulatory effector to sustain the survival of CD8+ T cells, primarily by inducing increased expression of the IL-2 gene. Full length human CD27 Ligand is a 193 amino acid protein, consisting of a 17 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 155 amino acid extracellular domain. Recombinant Human Soluble CD27 Ligand corresponds to the 155 amino acid extracellular domain of the full length CD27 Ligand protein plus an N-terminal His-Tag and has a calculated molecular weight of approximately 18.8 kDa.
More Information
| Size | 500 µg |
|---|---|
| Source | CHO cells |
| Biological Activity | Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors. |
| Purity Confirmation | >95% by SDS-PAGE & HPLC analysis |
| Length [aa] | 171 |
| Molecular Weight | 18.8 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | 20mM Sodium Citrate, pH 3.0 |
| Protein Sequence | HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Reconstitution | Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carri |
| Stability and Storage | The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C. |
| Synonyms | CD27L; CD27LG; TNFSF7 |
| Uniprot ID | P32970 |
| Protein RefSeq | NP_001243.1 |
| mRNA RefSeq | NM_001252.3 |

