human CD27 ligand, soluble protein (His-Tag) Human 250 µg

In stock

Cat-Nr.
S01-041-L250
Size
250 µg
€581.00

Description / human CD27 ligand, soluble protein (His-Tag)

CD27 Ligand, a type II transmembrane protein, is a member of the TNF superfamily. It is expressed on activated T and B lymphocytes as well as NK cells. CD27 Ligand and its receptor (CD27) regulate the immune response by promoting T-cell expansion and differentiation, as well as NK enhancement. CD27 signalling can act as a costimulatory effector to sustain the survival of CD8+ T cells, primarily by inducing increased expression of the IL-2 gene. Full length human CD27 Ligand is a 193 amino acid protein, consisting of a 17 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 155 amino acid extracellular domain. Recombinant Human Soluble CD27 Ligand corresponds to the 155 amino acid extracellular domain of the full length CD27 Ligand protein plus an N-terminal His-Tag and has a calculated molecular weight of approximately 18.8 kDa.

More Information

Size 250 µg
Source CHO cells
Biological Activity Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
Purity Confirmation >95% by SDS-PAGE & HPLC analysis
Length [aa] 171
Molecular Weight 18.8 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 20mM Sodium Citrate, pH 3.0
Protein Sequence HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Reconstitution Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carri
Stability and Storage The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
Synonyms CD27L; CD27LG; TNFSF7
Uniprot ID P32970
Protein RefSeq NP_001243.1
mRNA RefSeq NM_001252.3

All prices plus VAT + possible delivery charges