Description / human CD27 ligand, soluble protein (His-Tag)
CD27 Ligand, a type II transmembrane protein, is a member of the TNF superfamily. It is expressed on activated T and B lymphocytes as well as NK cells. CD27L and its receptor (CD27) regulate the immune response by promoting T-cell expansion and differentiation, as well as NK enhancement. CD27 signaling can act as a co-stimulatory effector to sustain the survival of CD8+ T cells, primarily by inducing increased expression of the IL-2 gene. Full length human CD27L is a 193 amino acid protein, consisting of a 17 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 155 amino acid extracellular domain. Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. The provided human sCD27L protein contains the extracellular domain plus an N-terminal His-Tag.
More Information
| Size | 10 µg |
|---|---|
| Source | CHO cells |
| Biological Activity | Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors. |
| Purity Confirmation | >95% by SDS-PAGE & HPLC analysis |
| Length [aa] | 155 |
| Molecular Weight | 18.8 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | 20mM Sodium Citrate, pH 3.0 |
| Protein Sequence | HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Reconstitution | Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carri |
| Stability and Storage | The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C. |
| Synonyms | CD27L; CD27LG; TNFSF7 |
| Uniprot ID | P32970 |
| Protein RefSeq | NP_001243.1 |
| mRNA RefSeq | NM_001252.3 |

