human CD105/Endoglin, soluble protein Human 25 µg

In stock

Cat-Nr.
S01-025
Size
25 µg
€214.00

Description / human CD105/Endoglin, soluble protein

A cDNA sequence encoding the extracellular domain of human Endoglin (Met 1 - Leu 586) was expressed in insect cells. Human Endoglin is a disulfide-linked homodimeric protein. According to N-terminal sequence analysis the primary structure of recombinant mature Endoglin starts at Glu 26. Endoglin has a calculated monomeric molecular mass of 61 kDa but as a result of glycosylation, migrates at approximately 70 - 75 kDa under reducing conditions in SDS-PAGE. Endoglin, also known as CD105, is a Type I integral membrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated, cytoplasmic tail. Two splice variants of human Endoglin, the S-Endoglin and L-Endoglin that differ in the length of their cytoplasmic tails have been identified. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, bone marrow pro-erythroblasts, and leukemic cells of lymphoid and myeloid lineages. Human and mouse Endoglin share approximately 70% and 97 % amino acid sequence identity in their extracellular and intracellular domains, respectively. Endoglin has been shown to be a powerful marker of neovascularization. It is also useful as a functional marker that defines long-term repopulating hematopoietic stem cells.

More Information

Size 25 µg
Source Insect cells
Biological Activity Testing in Progress.
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 565
Molecular Weight 70-75 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK
Reconstitution The lyophilized sCD105 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sCD105 should be stored in working aliquots at -20°C.
Synonyms Endoglin; END; ORW; HHT1; ORW1; CD105
Uniprot ID P17813
Protein RefSeq NP_000109
mRNA RefSeq NM_000118

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA60
€316.00

In stock

SKU: 101-M160
€453.00

In stock

SKU: 101-M192
€453.00

In stock

All prices plus VAT + possible delivery charges