human CCM-3 protein Human 20 µg

In stock

Cat-Nr.
300-056
Size
20 µg
  €134.00

Description / human CCM-3 protein

Cerebral cavernous malformations (CCMs) are sporadically acquired or inherited vascular lesions of the central nervous system consisting of clusters of dilated thin-walled blood vessels that predispose individuals to seizures and stroke. Mutations in CCM1, CCM2, or CCM3 lead to cerebral cavernous malformations, one of the most common hereditary vascular diseases of the brain. Endothelial cells within these lesions are the main disease compartments. Here, we show that adenoviral CCM3 expression inhibits endothelial cell migration, proliferation, and tube formation while down regulation of endogenous CCM3 results in increased formation of tube-like structures. Adenoviral CCM3 expression does not induce apoptosis under normal endothelial cell culture conditions but protects endothelial cells from staurosporine-induced cell death. Tyrosine kinase activity profiling suggests that CCM3 supports PDPK-1/Akt-mediated endothelial cell quiescence and survival (Schleider et al, Neurogenetics 12, 2011). The CCM-3 is fused to a N-terminal His-tag (6x His).

More Information

Size 20 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 231
Molecular Weight 26.7 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Reconstitution The lyophilized CCM3 is soluble in water and most aqueous buffers and should be reconstituted in water or PBS.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted CCM-3 should be stored in working aliquots at -20°C.
Synonyms PDCD10; CCM3; TFAR15; programmed cell death 10
Uniprot ID Q9BUL8
Protein RefSeq NP_009148
mRNA RefSeq NM_007217

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA27
€310.00

In stock

All prices plus VAT + possible delivery charges