Description / mouse BMP-4 protein
Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. This E.coli derived murine BMP-4 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.
More Information
| Size | 100 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml. |
| Purity Confirmation | >98% by SDS-PAGE & HPLC analysis |
| Length [aa] | 106 |
| Molecular Weight | 23.9 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | 10mM Citric Acid |
| Protein Sequence | KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Reconstitution | Centrifuge vial prior to opening. Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing |
| Stability and Storage | The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C. |
| Synonyms | Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1 |
| Uniprot ID | P21275 |
| Protein RefSeq | NP_031580 |
| mRNA RefSeq | NM_007554 |

