Description / human BAFF protein
BAFF, a member of the TNF family of ligands, is expressed in T cells, macrophages, monocytes and dendritic cells. BAFF is involved in stimulation of B and T cell function, and is an important survival and maturation factor for peripheral B cells. BAFF signals through three different TNF receptors TACI, BCMA and BAFF-R. The human BAFF gene codes for a 285 amino acid type II transmembrane protein containing a 46 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 218 amino acid extracellular domain. Recombinant human soluble BAFF is a 153 amino acid polypeptide (17.0 kDa), which contains the TNF-like portion of the extracellular domain of BAFF.
More Information
| Size | 500 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by dose-dependent NFκB activation in HEK293 BCMA–NFκB reporter cells. The expected ED50 for this effect is 100-200ng/mL. |
| Purity Confirmation | > 95% by SDS-PAGE & HPLC analyses |
| Length [aa] | 152 |
| Molecular Weight | 17.0 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | 0.5 x PBS pH 7.5 + 0.5 mM DTT |
| Protein Sequence | AVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL |
| Synonyms | TNFSF13B; DTL; BAFF; BLYS; CD257; TALL1; THANK; ZTNF4; TALL-1; TNFSF20 |
| Uniprot ID | Q9Y275 |
| Protein RefSeq | NP_006564.1 |
| mRNA RefSeq | NM_006573.4 |

