human Angiopoietin-like protein 3 protein (His-Tag) Human 100 µg
Description / human Angiopoietin-like protein 3 protein (His-Tag)
ANGPTL-3 (Angiopoietin like protein 3) is a member of the angiopoietin family of structurally related proteins, characterized by a coiled N-terminal domain and a C-terminal fibrinogen like domain. It is primarily expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism. ANGPTL-3 inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), which has the effect of increasing plasma levels of triglycerides and HDL associated cholesterol. The fibrinogen like portion of the ANGPTL-3 protein can bind alpha-5/beta-3 integrins leading to endothelial cell adhesion and migration. Recombinant human ANGPTL-3 is a glycoprotein that migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa, and contains 452 amino acid residues including a C-terminal His tag.
More Information
| Size | 100 µg |
|---|---|
| Source | CHO cells |
| Biological Activity | Measured by its binding ability to recombinant αvβ3 integrin in a functional ELISA. |
| Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
| Length [aa] | 452 |
| Molecular Weight | 62 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH |
| Synonyms | ANGPTL-3, ANG-5, ANGPT5 |
| Uniprot ID | Q9Y5C1 |
| Protein RefSeq | NP_055310.1 |
| mRNA RefSeq | NM_014495.3 |

