Description / Angiopoietin-like protein 3
ANGPTL-3 (Angiopoietin like protein 3) is a member of the angiopoietin family of structurally related proteins, characterized by a coiled N-terminal domain and a C-terminal fibrinogen like domain. It is primarily expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism. ANGPTL-3 inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), which has the effect of increasing plasma levels of triglycerides and HDL associated cholesterol. The fibrinogen like portion of the ANGPTL-3 protein can bind alpha-5/beta-3 integrins leading to endothelial cell adhesion and migration. Recombinant human ANGPTL-3 is a glycoprotein that migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa, and contains 452 amino acid residues including a C-terminal His tag.
More Information
Size | 10 µg |
---|---|
Source | CHO cells |
Biological Activity | Measured by its binding ability to recombinant αvβ3 integrin in a functional ELISA. |
Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
Length [aa] | 452 |
Molecular Weight | 62 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Protein Sequence | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH |
Synonyms | ANGPTL-3, ANG-5, ANGPT5 |
Uniprot ID | Q9Y5C1 |
Protein RefSeq | NP_055310.1 |
mRNA RefSeq | NM_014495.3 |