human Angiopoietin-like protein 3 protein (His-Tag) Human 50 µg

In stock

Cat-Nr.
100-402
Size
50 µg
  €221.00

Description / human Angiopoietin-like protein 3 protein (His-Tag)

ANGPTL-3 (Angiopoietin like protein 3) is a member of the angiopoietin family of structurally related proteins, characterized by a coiled N-terminal domain and a C-terminal fibrinogen like domain. It is primarily expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism. ANGPTL-3 inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), which has the effect of increasing plasma levels of triglycerides and HDL associated cholesterol. The fibrinogen like portion of the ANGPTL-3 protein can bind alpha-5/beta-3 integrins leading to endothelial cell adhesion and migration.  Recombinant human ANGPTL-3 is a glycoprotein that migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa, and contains 452 amino acid residues including a C-terminal His tag.

More Information

Size 50 µg
Source CHO cells
Biological Activity Measured by its binding ability to recombinant αvβ3 integrin in a functional ELISA.
Purity Confirmation > 97% by SDS-PAGE & HPLC analyses
Length [aa] 452
Molecular Weight 62 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Synonyms ANGPTL-3, ANG-5, ANGPT5
Uniprot ID Q9Y5C1
Protein RefSeq NP_055310.1
mRNA RefSeq NM_014495.3

All prices plus VAT + possible delivery charges