human Angiopoietin-2 / Ang-2 protein Human 100 µg

In stock

Cat-Nr.
300-050-L100
Size
100 µg
€937.00

Description / human Angiopoietin-2 / Ang-2 protein

ANG-2 binds to the endothelial cell specific receptor Tie-2, but, in contrast to ANG-1, does not induce tyrosine phosphorylation. Consequently, ANG-2 modulates ANG-1 activation of Tie-2 and, depending on the physiological and biochemical environment, can act either as an agonist or antagonist of Tie-2 induced angiogenesis. The signaling interactions of ANG-1, ANG-2 and Tie-2, along with less characterized ANG-3 and ANG-4, are required for embryonic and adult angiogenesis. Physiologically, ANG-1 and ANG-2 are associated with sprouting, tube formation, and structural integrity of newly formed blood vessels. Mature human ANG-2 is a secreted protein containing 480 amino acid residues. ANG-2 is composed of an alpha-helix-rich "coiled coil" N-terminal domain and fibrinogen-like C-terminal domain. ANG-2 exists predominantly in the form of a disulfide-linked dimer. Recombinant Human ANG-2 is a C-terminal histidine-tagged glycoprotein which migrates with an apparent molecular mass of 60.0-70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows an N-terminal sequence starting with residue 68 (D) of the ANG-2 precursor protein. The calculated molecular weight of Recombinant Human ANG-2 is 50.1 kDa.

More Information

Size 100 µg
Source CHO cells
Biological Activity Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2 μg/ml
Purity Confirmation > 95% by SDS-PAGE & HPLC analyses
Length [aa] 435
Molecular Weight 60.0-70.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 10 mM Sodium Phosphate, pH 8.0
Protein Sequence DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGW
Reconstitution Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carri
Stability and Storage The lyophilized protein is stable at room temperature for 1 month and at 4°C for 3 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
Synonyms ANGPT2; ANG2; AGPT2
Uniprot ID Q15123
Protein RefSeq NP_001138
mRNA RefSeq NM_001147.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges