Description / human Amphiregulin (98aa) protein
Amphiregulin is an EGF related growth factor that signals through the EGF/TGF-a receptor, and stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein. There are 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds essential for biological activity. Recombinant human Amphiregulin is a 11.3 kDa glycoprotein consisting of 98 amino acid residues.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED50 for this effect is 5-10 ng/ml. |
| Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
| Length [aa] | 98 |
| Molecular Weight | 11.3 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
| Synonyms | AREG; AR; SDGF; AREGB; CRDGF |
| Uniprot ID | P15514 |
| Protein RefSeq | NP_001648.1 |
| mRNA RefSeq | NM_001657.2 |