aeromonas Aminopeptidase protein Aeromonas 500 µg

In stock

Cat-Nr.
100-401
Size
500 µg
€217.00

Description / aeromonas Aminopeptidase protein

Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at or adjacent to specific residues or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Recombinant Aeromonas Aminopeptidase is a 31.4 kDa protein containing 291 amino acid residues.

More Information

Size 500 µg
Source E. coli
Biological Activity Sequentially cleaves N-terminal amino acids except E, D, and X-P.
Purity Confirmation > 95% by SDS-PAGE & HPLC analyses
Length [aa] 291
Molecular Weight 31.4kDa
Formulation lyophilized
Protein Sequence MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTT
Synonyms Proteolytic Enzymes, Peptidases,Proteinases
Uniprot ID Q01693

All prices plus VAT + possible delivery charges