human 4-1BBL protein Human 1000 µg

In stock

Cat-Nr.
100-001-L1000
Size
1000 µg
  €3,215.00

Description / human 4-1BBL protein

4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.

More Information

Size 1000 µg
Source E. coli
Biological Activity Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors.
Purity Confirmation > 97% by SDS-PAGE & HPLC analyses
Length [aa] 185
Molecular Weight 19.5 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Synonyms TNFSF9; CD137L; 4-1BB-L
Uniprot ID P41273
Protein RefSeq NP_003802.1
mRNA RefSeq NM_003811.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P218
€271.00

In stock

All prices plus VAT + possible delivery charges