human 4-1BBL protein Human 500 µg
Description / human 4-1BBL protein
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.
More Information
| Size | 500 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors. |
| Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
| Length [aa] | 185 |
| Molecular Weight | 19.5 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Synonyms | TNFSF9; CD137L; 4-1BB-L |
| Uniprot ID | P41273 |
| Protein RefSeq | NP_003802.1 |
| mRNA RefSeq | NM_003811.3 |

