Human Lyve-1, soluble
Slide this table
| Cat-Nr. | S01-028 |
| Size | 20 µg |
| Price | 120 € |
| Source | Insect cells |
| Label | His-Tag |
| Formulation | lyophilized |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 215 |
| Molecular Weight | ~ 35.0 - 45.0 kDa |
| N Terminal Sequence | SLRAEELSI |
| Biological Activity | Not tested so far! |
| Species Reactivity | Human |
| Buffer | PBS |
| Reconstitution | The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml. |
| Stability and Storage | lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
| Synonyms | LYVE1; HAR; XLKD1; LYVE-1; CRSBP-1 |
| Description | A DNA sequence encoding the extracellular domain of human LYVE-1 (Met1 to Gly232) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ser24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves. |
| Protein Sequence | SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGHHHHHH |
| Uniprot ID | Q9Y5Y7 |
| Protein RefSeq | NP_006682 |
| mRNA RefSeq | NM_006691 |
Figures
SDS-PAGE analysis of recombinant human soluble LYVE-1 from insect cells. Sample was loaded in 10% SDS-polyacrylamide gel under reducing condition and visualized with Silver stain.
All prices plus VAT + possible delivery charges